PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10022259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 243aa    MW: 27491.7 Da    PI: 8.5016
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10022259genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-171764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      Lus10022259 17 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 64
                     79********************************************97 PP

2Myb_DNA-binding55.31.5e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ d++ ++G++ W++Ia++++ gRt++++k++w++
      Lus10022259  70 RGNITPEEQLLIMDLHSKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 113
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4091264IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.1E-231367IPR009057Homeodomain-like
SuperFamilySSF466892.46E-3015111IPR009057Homeodomain-like
SMARTSM007177.2E-131666IPR001005SANT/Myb domain
PfamPF002493.4E-161764IPR001005SANT/Myb domain
CDDcd001671.04E-101964No hitNo description
PROSITE profilePS5129425.12365119IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-2568120IPR009057Homeodomain-like
SMARTSM007174.7E-1569117IPR001005SANT/Myb domain
PfamPF002495.9E-1670113IPR001005SANT/Myb domain
CDDcd001671.40E-1274113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEKKGISNTQ IEAEVRKGPW TMEEDLILIN YIANHGEGVW NSLAKAAGLK RTGKSCRLRW  60
LNYLRPDVRR GNITPEEQLL IMDLHSKWGN RWSKIAKHLP GRTDNEIKNY WRTRIQKHLK  120
QADHHHQQQQ RFPSSGHPGI GLDQMMTMGR ETSASNNNTS HVSADTMEMD YSPPASHHHY  180
NNNHHHHFDV GFPGASAAPT SKMATSGSSS NMQPPPPPLE SAEGYSWSME ELWSMQLLNG  240
DQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-251411924128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235850.19e-88MYB transcription factor MYB181
SwissprotP813915e-83MYB05_ANTMA; Myb-related protein 305
TrEMBLQ0PJJ61e-87Q0PJJ6_SOYBN; MYB transcription factor MYB181
STRINGGLYMA16G07960.13e-87(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-80myb domain protein 21